General Information

  • ID:  hor002027
  • Uniprot ID:  O97686
  • Protein name:  GnRH-associated peptide 2
  • Gene name:  GNRH2
  • Organism:  Suncus murinus (Asian house shrew) (Musk shrew)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  Midbrain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Suncus (genus), Crocidurinae (subfamily), Soricidae (family), Eulipotyphla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SPDSPQDPQPAPRFPEGYWLGLAAGNPRQSTQSLPSKALAPPEDTVSEEAKTMAWWHLQKQRLIQTLLPRP
  • Length:  71(40-110)
  • Propeptide:  MASIGQGLVLLLLLLLLTAQPGPLKAQHWSHGWYPGGKRSPDSPQDPQPAPRFPEGYWLGLAAGNPRQSTQSLPSKALAPPEDTVSEEAKTMAWWHLQKQRLIQTLLPRP
  • Signal peptide:  MASIGQGLVLLLLLLLLTAQPGPLKA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O97686-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002027_AF2.pdbhor002027_ESM.pdb

Physical Information

Mass: 916467 Formula: C355H549N99O105S
Absent amino acids: C Common amino acids: P
pI: 7.55 Basic residues: 8
Polar residues: 15 Hydrophobic residues: 21
Hydrophobicity: -85.92 Boman Index: -13450
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 63.38
Instability Index: 9327.04 Extinction Coefficient cystines: 17990
Absorbance 280nm: 257

Literature

  • PubMed ID:  NA
  • Title:  NA